Skip to content

Repository files navigation

DEPRECATION NOTICE

This project is no longer maintained and the pretrained weights hosted on the server have been removed. Please use the bio_embeddings library instead:

pip install bio-embeddings[cpcprot]

See the bio_embeddings.embed documentation for details.

CPCProt

Parameter-efficient embeddings for proteins, pretrained using a contrastive loss to maximize mutual information between local and sequentially global embeddings.

For more details, see: https://www.biorxiv.org/content/10.1101/2020.09.04.283929v1.full.pdf.

Contents

Pretrained Model Weights

Pretrained model weights are hosted here. This server is no longer maintained.

To download weights for the default (i.e. most parameter-efficient) version of the CPCProt model:

cd<directory_to_store_weights>
wget http://hershey.csb.utoronto.ca/CPCProt/weights/CPCProt__pretrained/best.ckpt

To download the CPCProt_LSTM and CPCProt_GRU_Large model variants reported in our paper, replace CPCProt__pretrained with CPCProt_LSTM__pretrained and CPCProt_GRU_large__pretrained, respectively.

Embedding Proteins with CPCProt

Installation

git clone https://github.com/amyxlu/CPCProt.git
cd CPCProt
pip install -e .

API for Embedding Protein Sequences

To embed a single sequence using the default model configurations, this HuggingFace-like interface can be used:

importtorchfromCPCProt.tokenizerimportTokenizerfromCPCProtimportCPCProtModel, CPCProtEmbeddingckpt_path="data/best.ckpt"# Replace with actual path to CPCProt weightsmodel=CPCProtModel()
model.load_state_dict(torch.load(ckpt_path))
embedder=CPCProtEmbedding(model)
tokenizer=Tokenizer()
# Example primary sequenceseq="LITRSVSRPLRYAVDIIEDIAQGNLRRDVSVTGKDEVSRLLAAMSSQRERLSA"# Tokenize and convert to torch tensorinput=torch.tensor([tokenizer.encode(seq)]) # (1, L)# We note three ways to obtain pooled embeddings from CPCProt.# z_mean and c_mean are the averages of non-padded tokens in z and c, respectively.# In our paper, we find that z_mean is best for tasks where local effects# are important (e.g. deep mutational scanning tasks)# c_final is the final position of the context vector.# We find that this is best for tasks where global information# is important (e.g. remote homology tasks).z_mean=embedder.get_z_mean(input) # (1, 512)c_mean=embedder.get_c_mean(input) # (1, 512)c_final=embedder.get_c_final(input) # (1, 512)# $z$ is the output of the CPCProt encoderz=embedder.get_z(input) # (1, L // 11, 512)# $c$ is the output of the CPCProt autoregressorc=embedder.get_c(input) # (1, L // 11, 512)

Instantiating CPCProtModel() will create a model using the default model configurations for embedding dimension, patch length, K, etc.

To embed using the CPCProt_LSTM and CPCProt_GRU_Large model variants, the CPCProtConfig class attributes must be modified.

importjsonimporttorchfromCPCProtimportCPCProtConfig, CPCProtModel, CPCProtEmbeddingconfig=CPCProtConfig()
# Update config class attributes with JSON configwithopen("model_configs/gru_large.json") asf: # Replace if path to config file is differentconfig_dict=json.load(f)
config.__dict__=config_dictmodel=CPCProtModel(config)
ckpt_path="data/gru_large/best.ckpt"# Replace with actual path to CPCProt_GRU_Large weightsstate_dict=dict(torch.load(ckpt_path))
# GRU_Large and LSTM variants were trained on multi-GPUs using DataParallel# Use this hack get state_dict keys to matchforiinlist(state_dict.keys()):
ifi.startswith('module.'):
state_dict[i[7:]] =state_dict[i]
delstate_dict[i]
model.load_state_dict(state_dict)
embedder=CPCProtEmbedding(model)
# Call methods for getting embeddings# ...

Embedding A FASTA File

To obtain static embeddings for an entire FASTA file, see embed_fasta.py, which saves computed NumPy embeddings as a .pkl file. An example command line usage:

python embed_fasta.py \
--fasta_file data/example.fasta \
--output_file data/example_embeddings.pkl \
--model_weights data/best.ckpt # path to where the model weight was saved.

python embed_fasta.py --help will bring up more options, default settings, etc.

For now, please ensure the header is consistent with that in the data/example.fasta file. In the future, we will make the FASTA dataloader compatible with more header formats.

Reproducibility

Pretraining

This repository also includes code for pretraining for reproducibility purposes.

We use Sacred for hyperparameter tracking, logging, and easy configuration from JSON. See the Sacred documentation for more details. Example configs with pretraining options are in the model_config folder.

Specifying Sacred parameters from the command line is documented here. Logging relies on Sacred logging observer classes; more information is here. By default, the FileStorageObserver is used.

To make use of the training and evaluation framework for benchmarking against Tasks Assessing Protein Embeddings (TAPE), we build on top of the framework at https://github.com/songlab-cal/tape. To install:

pip install tape-proteins==0.3

To run pretraining (ensure that tape-proteins and the packages specified in environment.txt are installed):

For consistency when comparing against benchmarks, we pretrain using the same data. For details on how to structure the data directory for pretraining, see the data documentation in the TAPE repository.

There should be a symlink between the project home directory to the directory where data is stored. Logs will also be stored here, in a subdirectory logs/. To specify hyperparameters from the command line:

python pretrain.py with "batch_size=128" 

An example for sweeping hyperparameters with SLURM is in launch_scripts/sweep_batchsize.sh.

Finetuning

CPCProt/finetune_simple.py trains a single model using a LR/kNN head on static CPC/BERT/UniREP embeddings. To train a grid of models on a cluster, use launch_scripts/finetune_simple.sh, updating cpc_models_folder, output_folder and data_root

As noted in our paper, for consistency with benchmarks, finetuning results using MLP/CNN heads uses the tape-train and tape-eval interfaces. We use a light wrapper around the interface (CPCProt/finetune.py and CPCProt/evaluate.py), which allows us register downstream heads. The TAPE interface does not allow us to specify downstream hyperparameters (ex: embedding method, CPC model path) as command line arguments - only as a JSON file.

An example call to the training and evaluation scripts is shown in launch_scripts/finetune.sh. The script launch_scripts/run_finetuning.py will generate json files for each hyperparameter combination for each model, and run them on a cluster. Update the path for cpc_models_folder in run_finetuning.py and output_folder and data_root in finetune.sh.

Contact

amyxlu [at] cs [dot] toronto [dot] edu.

About

Parameter-efficient embeddings for proteins, pretrained using a contrastive loss.

Resources

Stars

30 stars

Watchers

3 watching

Forks

Releases

Packages

Contributors

Languages