Skip to content
View khalilcharfi's full-sized avatar
324 followers · 2.7k following

Block or report khalilcharfi

Block user

Prevent this user from interacting with your repositories and sending you notifications. Learn more about blocking users.

You must be logged in to block users.

Content in all repositories owned by your account will be closed.
Maximum 250 characters. Please don’t include any personal information such as legal names or email addresses. Markdown is supported. This note will only be visible to you.
Report abuse

Contact GitHub support about this user’s behavior. Learn more about reporting abuse.

Report abuse
khalilcharfi/README.md

Hi , I'm Khalil CHARFI

A passionate developer from 🇹🇳

khalilcharfi

Connect with me:

khalil-charfikhalilcharfi85181098khalilcharfikhalilcharfi

Languages and Tools:

androidangularjsfluttercouchdbcss3dockerelectronfirebasegithtml5illustratorionicjavajavascriptlinuxmariadbmongodbmysqlnodejsphppostgresqlpostmansasssqlitelaraveltypescriptlaminas

Popular repositories Loading

  1. laravel-keycloak-admin laravel-keycloak-adminPublic

    PHP 3

  2. sci-trick sci-trickPublic

    Forked from hamdiBh/sci-trick

    Chrome extension that appends ".sci-hub.se" to active tab domain, allowing free access to scientific articles.

    JavaScript 3

  3. khalilcharfi.github.io khalilcharfi.github.ioPublic template

    Personal website

    HTML 2

  4. app-ideas app-ideasPublic

    Forked from florinpop17/app-ideas

    A Collection of application ideas which can be used to improve your coding skills.

    2

  5. Wasselni WasselniPublic

    Forked from mohamedebrahim96/Wasselni

    Use Wasselni to get an affordable ride in minutes. Ride-sharing with Wasselni lets you request a car with the tap of a button and get picked up by a nearby friendly driver who’ll take you to your d…

    Kotlin 2

  6. khalilcharfi khalilcharfiPublic

    2 4