Baebeca-Solutions / lexware-php-api Star 43 Code Issues Pull requests PHP Client für office.lexware.de API (ehemals lexoffice.de)phpphp7api-clientapi-wrapperlexwarephp8api-clientslexoffice-php-apilexofficeapi-client-phplex-officephp-81php-82php83php-84lexware-officelexware-php-apilexware-puplic-apilexoffice-public-api Updated Aug 16, 2026PHP
zyekhabdul / laravel-12-enterprise Star 1 Code Issues Pull requests 🏛️ Production-ready Laravel 12 enterprise boilerplate featuring Domain-Driven Design (DDD), strict typing, CI/CD, and TDD setup.boilerplatedomain-driven-designclean-architectureenterprise-architecturepest-phpphp-84laravel-12 Updated Aug 2, 2026PHP
uros196 / moneymosaic Star 0 Code Issues Pull requests Personal income and expense management application powered by the latest Laravel 12 and Inertia.js stack.reactmysqlphplaraveldatabasesinertiaphp-84tailwindcss-v4laravel-boost Updated Apr 21, 2026PHP