gershnik / intrusive_shared_ptr Star 27 Code Issues Pull requests Intrusive reference counting smart pointer, highly configurable reference counted base class and various adapterscpluspluscppheader-onlyreference-countcpp17c-plus-plus-17no-dependenciesreference-countingweak-referencecplusplus-17cpp20cplusplus-20c-plus-plus-20 Updated Jun 24, 2026C++
ByteAether / WeakEvent Star 27 Code Issues Pull requests Weakly referenced event subscribers. Keep your .NET events lean and memory-safe.csharpdotneteventweak-referenceweak-eventblazor Updated Aug 10, 2026C#
nicholascross / WeakDictionary Star 11 Code Issues Pull requests naive (strong key/weak value) dictionary & (weak key/weak value) dictionary implementations in swiftswiftdictionaryweak-referencesweak-reference Updated Jun 2, 2019Swift
khamitimur / AmazingWeakSequence Star 2 Code Issues Pull requests Sequence that holds weak references to its elements.swiftweak-referenceswift5 Updated Apr 13, 2021Swift
findstr / Eliminating-Cycles-in-Weak-Tables Star 0 Code Issues Pull requests Eliminating Cycles in Weak Tablesluapapercycle-referenceweak-tableweak-reference Updated Aug 28, 2017
mgnsk / weakcache Star 0 Code Issues Pull requests Weak cache implementation in go.gogolangruntimereferenceweakmapttlreference-countingweak-referencefinalizerweakcachemaphash Updated Apr 9, 2020Go